PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna07984.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 465aa    MW: 52286.2 Da    PI: 9.8656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna07984.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.92.3e-08191235345
                              SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 
                              +WT+ E + + +a +++ ++   +W+++a++++ g+t  +++  + 
  mrna07984.1-v1.0-hybrid 191 KWTPAENKMFENALALHDKDtpdRWHKVAEMIP-GKTVGDVVQQYK 235
                              8********************************.****99998876 PP

2Myb_DNA-binding45.51.7e-14299343347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT++E++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  mrna07984.1-v1.0-hybrid 299 PWTEDEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 343
                              8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-4185236IPR009057Homeodomain-like
PROSITE profilePS512939.08187242IPR017884SANT domain
SMARTSM007179.0E-10188240IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-10190244IPR009057Homeodomain-like
PfamPF002495.4E-7191235IPR001005SANT/Myb domain
CDDcd001678.21E-8191237No hitNo description
PROSITE profilePS5129420.945292348IPR017930Myb domain
SuperFamilySSF466892.39E-16294348IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17295347IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.5E-12296342IPR009057Homeodomain-like
SMARTSM007171.1E-12296346IPR001005SANT/Myb domain
PfamPF002493.3E-12299343IPR001005SANT/Myb domain
CDDcd001671.33E-10299344No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MQTTKFRAFY DYKQLEILEQ CPRPDERVDT ASLFFNSTSQ AKKRIISELR GGGWREEAAI  60
TYDGSRKTRE LPPFKANRVM TRVDAASRKT EERRDLPPTF SHSIPPSLSV PIAFSPIYCF  120
SSLVFLIGFP KRLQWVQIPL LVLGVYLGVL GFNIIFNTIP LNFGKLEMGI LSPSSYFSDS  180
NWLPEETKSA KWTPAENKMF ENALALHDKD TPDRWHKVAE MIPGKTVGDV VQQYKELEAD  240
VGKIEAGLVP IPGYGTSPFT LEWVNRHGYD IGFKQTYGIG GKKSSSTRPA DHERKKGVPW  300
TEDEHKLFLM GLKKYGKGDW RNISRNFVVT RTPTQVASHA QKYFIRQHSG GKDKRRASIH  360
DITTVNLGDT CRTPSPDNKP PSPDHHHSSA FSQQPNSARI PPFQWQQGGN GANMAFGQAH  420
GNLFMSNTHG IGSYGLNKSS VHESYYAPQN LAFQMQSAHH YLHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-141922571176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294268.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-128DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0MSI11e-156A0A0B0MSI1_G
STRINGPOPTR_0001s25590.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-100Homeodomain-like transcriptional regulator